Product Description
Recombinant Human U6 snRNA-associated Sm-like protein LSm4 (LSM4) is available at Gentaur for Next week Delivery.
Gene Name: LSM4
Alternative Names : Glycine-rich protein;GRP
Expression Region : 1-139aa
AA Sequence : MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 31.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Function : Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : SnRNP Sm proteins family
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y4Z0
Euro
British Pound
US Dollar