Recombinant Human U6 snRNA-associated Sm-like protein LSm4 (LSM4)

Product Description

Recombinant Human U6 snRNA-associated Sm-like protein LSm4 (LSM4) is available at Gentaur for Next week Delivery.

Gene Name: LSM4

Alternative Names : Glycine-rich protein;GRP

Expression Region : 1-139aa

AA Sequence : MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 31.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds specifically to the 3'-terminal U-tract of U6 snRNA.

Function : Binds specifically to the 3'-terminal U-tract of U6 snRNA.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : SnRNP Sm proteins family

Tissue Specificity :

Paythway :

Uniprot ID : Q9Y4Z0