Product Description
Recombinant Human Uncharacterized protein C4orf3 (C4orf3), partial is available at Gentaur for Next week Delivery.
Gene Name: C4orf3
Alternative Names : Hepatitis C virus F protein-transactivated protein 1;HCV F-transactivated protein 1
Expression Region : 1-44aa
AA Sequence : MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 20.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Membrane, Single-pass membrane protein
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q8WVX3
 Euro
            
 British Pound
            
 US Dollar