Product Description
Recombinant Human UPF0468 protein C16orf80 (C16orf80) is available at Gentaur for Next week Delivery.
Gene Name: C16orf80
Alternative Names : Basal body up-regulated protein 22 Transcription factor IIB
Expression Region : 1-193aa
AA Sequence : MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 49.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation
Function : Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia
Involvement in disease :
Subcellular location : Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole, Cytoplasm, cytoskeleton, cilium basal body, Cell projection, cilium
Protein Families : CFAP20 family
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y6A4
 Euro
            
 British Pound
            
 US Dollar