Recombinant Human UPF0468 protein C16orf80 (C16orf80)

Product Description

Recombinant Human UPF0468 protein C16orf80 (C16orf80) is available at Gentaur for Next week Delivery.

Gene Name: C16orf80

Alternative Names : Basal body up-regulated protein 22 Transcription factor IIB

Expression Region : 1-193aa

AA Sequence : MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 49.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation

Function : Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole, Cytoplasm, cytoskeleton, cilium basal body, Cell projection, cilium

Protein Families : CFAP20 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9Y6A4