Recombinant Human UPF0568 protein C14orf166 (C14orf166)

Product Description

Recombinant Human UPF0568 protein C14orf166 (C14orf166) is available at Gentaur for Next week Delivery.

Gene Name: C14orf166

Alternative Names : CLE7 homolog

Expression Region : 1-244aa

AA Sequence : MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 55.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. In case of infection by influenza virus A, is involved in viral replication. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport

Function : RNA-binding protein involved in modulation of mRNA transcription by Polymerase II

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm, cytosol, Cytoplasm, perinuclear region, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Note=May localize at the centrosome during mitosis (PubMed:15147888), Shuttles between the cytosol and the nucleus: enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low (PubMed:24608264), SUBCELLULAR LOCATION: Nucleus, Cytoplasm

Protein Families : RTRAF family

Tissue Specificity : Widely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in many brain tumors.

Paythway :

Uniprot ID : Q9Y224