Product Description
Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: VAPB
Alternative Names : Vesicle-associated membrane protein-associated protein B/C;VAMP-B/VAMP-C;VAMP-associated protein B/C;VAP-B/VAP-C
Expression Region : 2-132aa
AA Sequence : AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 16 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.
Function : Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Involvement in disease : Amyotrophic lateral sclerosis 8 (ALS8); Spinal muscular atrophy, proximal, adult, autosomal dominant (SMAPAD)
Subcellular location : Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families : VAMP-associated protein (VAP) (TC 9.B.17) family
Tissue Specificity : Ubiquitous. Isoform 1 predominates.
Paythway : Cholesterolmetabolism
Uniprot ID : O95292
Euro
British Pound
US Dollar