Recombinant Human Visinin-like protein 1 (VSNL1)

Product Description

Recombinant Human Visinin-like protein 1 (VSNL1) is available at Gentaur for Next week Delivery.

Gene Name: VSNL1

Alternative Names : Hippocalcin-like protein 3

Expression Region : 1-191aa

AA Sequence : MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 49 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Function : Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Involvement in disease :

Subcellular location :

Protein Families : Recoverin family

Tissue Specificity : Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).

Paythway :

Uniprot ID : P62760