Product Description
Recombinant Human Visinin-like protein 1 (VSNL1) is available at Gentaur for Next week Delivery.
Gene Name: VSNL1
Alternative Names : Hippocalcin-like protein 3
Expression Region : 1-191aa
AA Sequence : MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 49 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Function : Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Involvement in disease :
Subcellular location :
Protein Families : Recoverin family
Tissue Specificity : Brain and retina. Neuron-specific in the central and peripheral nervous system. Increased in the cerebrospinal fluid of Alzheimer disease patients (at protein level).
Paythway :
Uniprot ID : P62760
Euro
British Pound
US Dollar