Product Description
Recombinant Human WD repeat-containing protein 1 (WDR1), partial is available at Gentaur for Next week Delivery.
Gene Name: WDR1
Alternative Names : Actin-interacting protein 1;AIP1NORI-1
Expression Region : 189-461aa
AA Sequence : HKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKE
Sequence Info : Partial of Isoform 2
Tag Info : N-terminal GST-tagged
Theoretical MW : 56.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins.
Function : Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins
Involvement in disease :
Subcellular location : Cytoplasm, cytoskeleton, Cell projection, podosome, Cell junction
Protein Families : WD repeat AIP1 family
Tissue Specificity :
Paythway :
Uniprot ID : O75083
Euro
British Pound
US Dollar