Recombinant Human WD repeat-containing protein 1 (WDR1), partial

Product Description

Recombinant Human WD repeat-containing protein 1 (WDR1), partial is available at Gentaur for Next week Delivery.

Gene Name: WDR1

Alternative Names : Actin-interacting protein 1;AIP1NORI-1

Expression Region : 189-461aa

AA Sequence : HKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKE

Sequence Info : Partial of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 56.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Induces disassbly of actin filaments in conjunction with ADF/cofilin family proteins.

Function : Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, Cell projection, podosome, Cell junction

Protein Families : WD repeat AIP1 family

Tissue Specificity :

Paythway :

Uniprot ID : O75083