Recombinant Human WNT1-inducible-signaling pathway protein 2 (WISP2)

Product Description

Recombinant Human WNT1-inducible-signaling pathway protein 2 (WISP2) is available at Gentaur for Next week Delivery.

Gene Name: WISP2

Alternative Names : CCN family member 5 Connective tissue growth factor-like protein

Expression Region : 1-250aa

AA Sequence : QLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 51.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Stem Cells

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.

Function : May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.

Involvement in disease :

Subcellular location : Secreted

Protein Families : CCN family

Tissue Specificity : Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.

Paythway :

Uniprot ID : O76076