Euro
British Pound
US Dollar
Product Description
Recombinant Human Zinc finger protein 91 (ZNF91), partial is available at Gentaur for Next week Delivery.
Gene Name: ZNF91
Alternative Names : Membrane-bound C2 domain-containing protein
Expression Region : 1-208aa
AA Sequence : MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEK
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 51.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane.
Function : Transcription factor specifically required to repress SINE-VNTR-Alu (SVA) retrotransposons
Involvement in disease :
Subcellular location : Nucleus
Protein Families : Krueppel C2H2-type zinc-finger protein family
Tissue Specificity :
Paythway :
Uniprot ID : Q05481
