Recombinant Human Zinc finger protein GLI1 (GLI1), partial

Product Description

Recombinant Human Zinc finger protein GLI1 (GLI1), partial is available at Gentaur for Next week Delivery.

Gene Name: GLI1

Alternative Names : Glioma-associated oncogeneOncogene GLI

Expression Region : 921-1106aa

AA Sequence : QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 23.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.

Function : Acts as a transcriptional activator

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : GLI C2H2-type zinc-finger protein family

Tissue Specificity : Detected in testis (at protein level) (PubMed:2105456). Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract (PubMed:19878745). Isoform 1 is detected in brain, spleen, pancreas, liver, kidney and placenta; isoform 2 is not detectable in these tissues (PubMed:19706761).

Paythway : cAMPsignalingpathway

Uniprot ID : P08151