Recombinant Human Zinc transporter ZIP1 (SLC39A1), partial

Product Description

Recombinant Human Zinc transporter ZIP1 (SLC39A1), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC39A1

Alternative Names : Solute carrier family 39 member 1Zinc-iron-regulated transporter-likeZrt- and Irt-like protein 1;ZIP-1;hZIP1

Expression Region : 126-179aa

AA Sequence : MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.

Function : Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families : ZIP transporter (TC 2.A.5) family

Tissue Specificity : Ubiquitous. Expressed in most adult and fetal tissues including the epidermis.

Paythway :

Uniprot ID : Q9NY26