Product Description
Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) is available at Gentaur for Next week Delivery.
Gene Name: hfb1
Alternative Names : Hydrophobin I Short name:HFBI
Expression Region : 23-97aa
AA Sequence : SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 23.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
Function : Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
Involvement in disease :
Subcellular location : Secreted, cell wall, Secreted
Protein Families : Cerato-ulmin hydrophobin family
Tissue Specificity :
Paythway :
Uniprot ID : P52754
Euro
British Pound
US Dollar