Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1)

Product Description

Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) is available at Gentaur for Next week Delivery.

Gene Name: hfb1

Alternative Names : Hydrophobin I Short name:HFBI

Expression Region : 23-97aa

AA Sequence : SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 23.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Function : Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Involvement in disease :

Subcellular location : Secreted, cell wall, Secreted

Protein Families : Cerato-ulmin hydrophobin family

Tissue Specificity :

Paythway :

Uniprot ID : P52754