Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase (lgt)

Product Description

Recombinant Lactococcus lactis subsp.lactis Prolipoprotein diacylglyceryl transferase (lgt) is available at Gentaur for Next week Delivery.

Gene Name: lgt

Alternative Names :

Expression Region : 1-261aa

AA Sequence : MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN

Sequence Info : Full Length

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 32.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.

Function : Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : Lgt family

Tissue Specificity :

Paythway :

Uniprot ID : Q9CHU9