Product Description
Recombinant Legionella pneumophila Outer membrane protein MIP (mip) is available at Gentaur for Next week Delivery.
Gene Name: mip
Alternative Names : Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name: PPIase
Expression Region : 21-233aa
AA Sequence : ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 24.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.
Function : Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.
Involvement in disease :
Subcellular location : Cell outer membrane
Protein Families : FKBP-type PPIase family
Tissue Specificity :
Paythway :
Uniprot ID : A5IGB8
Euro
British Pound
US Dollar