Recombinant Legionella pneumophila Outer membrane protein MIP (mip)

Product Description

Recombinant Legionella pneumophila Outer membrane protein MIP (mip) is available at Gentaur for Next week Delivery.

Gene Name: mip

Alternative Names : Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name: PPIase

Expression Region : 21-233aa

AA Sequence : ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Function : Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Involvement in disease :

Subcellular location : Cell outer membrane

Protein Families : FKBP-type PPIase family

Tissue Specificity :

Paythway :

Uniprot ID : A5IGB8