Product Description
Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA), partial is available at Gentaur for Next week Delivery.
Gene Name: inlA
Alternative Names :
Expression Region : 562-770aa
AA Sequence : QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 24.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mediates the entry of Listeria monocytogenes into cells.
Function : Mediates the entry of Listeria monocytogenes into cells.
Involvement in disease :
Subcellular location : Secreted, cell wall, Peptidoglycan-anchor
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q723K6
Euro
British Pound
US Dollar