Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA), partial

Product Description

Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA), partial is available at Gentaur for Next week Delivery.

Gene Name: inlA

Alternative Names :

Expression Region : 562-770aa

AA Sequence : QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates the entry of Listeria monocytogenes into cells.

Function : Mediates the entry of Listeria monocytogenes into cells.

Involvement in disease :

Subcellular location : Secreted, cell wall, Peptidoglycan-anchor

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q723K6