Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB)

Product Description

Recombinant Lolium perenne Major pollen allergen Lol p 5a (LOLPIB) is available at Gentaur for Next week Delivery.

Gene Name: LOLPIB

Alternative Names : Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a

Expression Region : 26-307aa

AA Sequence : ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 48.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Allergen

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location :

Protein Families : Poa p IX/Phl p VI allergen family

Tissue Specificity : Pollen, starch granules.

Paythway :

Uniprot ID : Q40240