Recombinant Lysobacter enzymogenes Beta-lytic metalloendopeptidase

Product Description

Recombinant Lysobacter enzymogenes Beta-lytic metalloendopeptidase is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Beta-lytic protease

Expression Region : 1-178aa

AA Sequence : SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cleavage of N-acetylmuramoyl-|-Ala, and of the insulin B chain at 23-Gly-|-Phe-24 > 18-Val-|-Cys(SO3H).

Function :

Involvement in disease :

Subcellular location :

Protein Families : Peptidase M23A family

Tissue Specificity :

Paythway :

Uniprot ID : P00801