Recombinant Macaca mulatta Growth hormone receptor (GHR), partial

Product Description

Recombinant Macaca mulatta Growth hormone receptor (GHR), partial is available at Gentaur for Next week Delivery.

Gene Name: GHR

Alternative Names : Somatotropin receptor

Expression Region : 19-264aa

AA Sequence : FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 30.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Function : Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway (By similarity).

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted

Protein Families : Type I cytokine receptor family, Type 1 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P79194