Product Description
Recombinant Mouse Angiogenin-4 (Ang4) is available at Gentaur for Next week Delivery.
Gene Name: Ang4
Alternative Names :
Expression Region : 25-144aa
AA Sequence : QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 29.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro)
Function : Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Involvement in disease :
Subcellular location : Cytoplasmic vesicle, secretory vesicle lumen, Secreted, Nucleus, nucleolus
Protein Families : Pancreatic ribonuclease family
Tissue Specificity : Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium.
Paythway :
Uniprot ID : Q3TMQ6
Euro
British Pound
US Dollar