Recombinant Mouse Beta-defensin 1 (Defb1)

Product Description

Recombinant Mouse Beta-defensin 1 (Defb1) is available at Gentaur for Next week Delivery.

Gene Name: Defb1

Alternative Names : Short name:BD-1 Short name:mBD-1

Expression Region : 33-69aa

AA Sequence : DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 20.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has bactericidal activity.

Function : Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Involvement in disease :

Subcellular location : Secreted, Membrane

Protein Families : Beta-defensin family

Tissue Specificity : Detected in kidney.

Paythway :

Uniprot ID : P56386