Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Beta-defensin 4 (Defb4) is available at Gentaur for Next week Delivery.
Gene Name: Defb4
Alternative Names : Defensin, beta 4
Expression Region : 23-63aa
AA Sequence : QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 20.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has bactericidal activity
Function : Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells
Involvement in disease :
Subcellular location : Secreted
Protein Families : Beta-defensin family
Tissue Specificity : Tongue, esophagus and trachea.
Paythway :
Uniprot ID : P82019
