Product Description
Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial is available at Gentaur for Next week Delivery.
Gene Name: Ccr5
Alternative Names : MIP-1 alpha receptor CD_antigen: CD195
Expression Region : 263-354aa
AA Sequence : QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity).
Function : Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity).
Involvement in disease :
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 1 family
Tissue Specificity :
Paythway :
Uniprot ID : P51682
Euro
British Pound
US Dollar