Recombinant Mouse C-C motif chemokine 7 (Ccl7), partial

Product Description

Recombinant Mouse C-C motif chemokine 7 (Ccl7), partial is available at Gentaur for Next week Delivery.

Gene Name: Ccl7

Alternative Names : Intercrine/chemokine MAR;CMonocyte chemoattractant protein 3Monocyte chemotactic protein 3;MCP-3;Protein FICSmall-inducible cytokine A7

Expression Region : 28-97aa

AA Sequence : PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 12.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity .

Function : Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine beta (chemokine CC) family

Tissue Specificity :

Paythway :

Uniprot ID : Q03366