Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial

Product Description

Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial is available at Gentaur for Next week Delivery.

Gene Name: Clec4a

Alternative Names : C-type lectin superfamily member 6 Dendritic cell immunoreceptor

Expression Region : 70-238aa

AA Sequence : QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 39.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Function : May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation (By similarity). May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families :

Tissue Specificity : Expressed in splenic antigen-presenting cells including B-cells, monocytes/macrophages, and dendritic cells (at protein level). Expressed in spleen and lymph node and slightly increased with dendritic cell maturation.

Paythway :

Uniprot ID : Q9QZ15