Product Description
Recombinant Mouse C-X-C motif chemokine 10 (Cxcl10) is available at Gentaur for Next week Delivery.
Gene Name: Cxcl10
Alternative Names : 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Expression Region : 22-98aa
AA Sequence : IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 35.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P17515
Euro
British Pound
US Dollar