Product Description
Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial is available at Gentaur for Next week Delivery.
Gene Name: Scyb11
Alternative Names : Interferon-inducible T-cell alpha chemoattractant;I-TACSmall-inducible cytokine B11
Expression Region : 22-98aa
AA Sequence : FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 12.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Chotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses .
Function : Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity :
Paythway :
Uniprot ID : Q9JHH5