Product Description
Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14) is available at Gentaur for Next week Delivery.
Gene Name: Cxcl14
Alternative Names : B-cell and monocyte-activating chemokineChemokine BRAKKidney-expressed chemokine CXCMIP-2GSmall-inducible cytokine B14
Expression Region : 23-99aa
AA Sequence : SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Chotactic for CESS B-cells and THP-1 monocytes, but not T-cells.
Function : Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Intercrine alpha (chemokine CxC) family
Tissue Specificity : Highly expressed in brain, lung, ovary, muscle and in kidney and liver parenchyma, and at lower levels in bone marrow.
Paythway :
Uniprot ID : Q9WUQ5
Euro
British Pound
US Dollar