Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14)

Product Description

Recombinant Mouse C-X-C motif chemokine 14 (Cxcl14) is available at Gentaur for Next week Delivery.

Gene Name: Cxcl14

Alternative Names : B-cell and monocyte-activating chemokineChemokine BRAKKidney-expressed chemokine CXCMIP-2GSmall-inducible cytokine B14

Expression Region : 23-99aa

AA Sequence : SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chotactic for CESS B-cells and THP-1 monocytes, but not T-cells.

Function : Chemotactic for CESS B-cells and THP-1 monocytes, but not T-cells.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity : Highly expressed in brain, lung, ovary, muscle and in kidney and liver parenchyma, and at lower levels in bone marrow.

Paythway :

Uniprot ID : Q9WUQ5