Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Product Description

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3) is available at Gentaur for Next week Delivery.

Gene Name: Cxcl3

Alternative Names : Dendritic cell inflammatory protein 11

Expression Region : 32-100aa

AA Sequence : SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Function : Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Intercrine alpha (chemokine CxC) family

Tissue Specificity :

Paythway :

Uniprot ID : Q6W5C0