Recombinant Mouse Cadherin-17 (Cdh17), partial

Product Description

Recombinant Mouse Cadherin-17 (Cdh17), partial is available at Gentaur for Next week Delivery.

Gene Name: Cdh17

Alternative Names : BILL-cadherin (Liver-intestine cadherin) (LI-cadherin) (P130)

Expression Region : 173-253aa

AA Sequence : INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9R100