Product Description
Recombinant Mouse Carbonic anhydrase 14 (Ca14), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: Ca14
Alternative Names : Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA-XIV; CA14;
Expression Region : 16-290aa
AA Sequence : ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Sequence Info : Partial
Tag Info : C-terminal 6xHis-tagged
Theoretical MW : 31.8 kDa
Storage Buffer : 0.2 ?m filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The esterase activity is determined to be greater than 400 pmol/min/µg.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mouse Ca14,also known as Carbonic anhydrase 14,is a member of large family of zinc metalloenzymes .It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system
Function : Reversible hydration of carbon dioxide.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Alpha-carbonic anhydrase family
Tissue Specificity : Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Paythway :
Uniprot ID : Q9WVT6
Euro
British Pound
US Dollar