Product Description
Recombinant Mouse Cathepsin L1 (Ctsl1), partial is available at Gentaur for Next week Delivery.
Gene Name: Ctsl
Alternative Names : Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)
Expression Region : 114-288aa
AA Sequence : IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT
Sequence Info : Partial
Tag Info : N-terminal 6xHis-taggedand C-terminal Myc-tagged
Theoretical MW : 26.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Important for the overall degradation of proteins in lysosomes.
Function : Important for the overall degradation of proteins in lysosomes.
Involvement in disease :
Subcellular location : Lysosome
Protein Families : Peptidase C1 family
Tissue Specificity :
Paythway :
Uniprot ID : P06797
Euro
British Pound
US Dollar