Recombinant Mouse Cathepsin L1 (Ctsl1), partial

Product Description

Recombinant Mouse Cathepsin L1 (Ctsl1), partial is available at Gentaur for Next week Delivery.

Gene Name: Ctsl

Alternative Names : Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)

Expression Region : 114-288aa

AA Sequence : IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-taggedand C-terminal Myc-tagged

Theoretical MW : 26.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Important for the overall degradation of proteins in lysosomes.

Function : Important for the overall degradation of proteins in lysosomes.

Involvement in disease :

Subcellular location : Lysosome

Protein Families : Peptidase C1 family

Tissue Specificity :

Paythway :

Uniprot ID : P06797