Product Description
Recombinant Mouse CD82 antigen (Cd82), partial is available at Gentaur for Next week Delivery.
Gene Name: Cd82
Alternative Names : C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82
Expression Region : 111-227aa
AA Sequence : DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 29.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Function : Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : Tetraspanin (TM4SF) family
Tissue Specificity : Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.
Paythway :
Uniprot ID : P40237
Euro
British Pound
US Dollar