Recombinant Mouse CD82 antigen (Cd82), partial

Product Description

Recombinant Mouse CD82 antigen (Cd82), partial is available at Gentaur for Next week Delivery.

Gene Name: Cd82

Alternative Names : C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82

Expression Region : 111-227aa

AA Sequence : DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Function : Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : Tetraspanin (TM4SF) family

Tissue Specificity : Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.

Paythway :

Uniprot ID : P40237