Product Description
Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a) is available at Gentaur for Next week Delivery.
Gene Name: Cela2a
Alternative Names : Elastase-2 Elastase-2A
Expression Region : 31-271aa
AA Sequence : VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 27.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Acts upon elastin.
Function : Acts upon elastin.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Peptidase S1 family, Elastase subfamily
Tissue Specificity : Pancreas.
Paythway :
Uniprot ID : P05208