Recombinant Mouse Collectrin (Cltrn), partial

Product Description

Recombinant Mouse Collectrin (Cltrn), partial is available at Gentaur for Next week Delivery.

Gene Name: Cltrn

Alternative Names : Transmembrane protein 27

Expression Region : 15-141aa

AA Sequence : ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 34.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulator of SNARE complex function. Stimulator of beta cell replication.

Function : Regulator of SNARE complex function. Stimulator of beta cell replication.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : TMEM27 family

Tissue Specificity : Kidney; collecting ducts. Pancreas; beta cells of islets.

Paythway :

Uniprot ID : Q9ESG4