Recombinant Mouse D-dopachrome decarboxylase (Ddt)

Product Description

Recombinant Mouse D-dopachrome decarboxylase (Ddt) is available at Gentaur for Next week Delivery.

Gene Name: Ddt

Alternative Names : D-dopachrome tautomerase

Expression Region : 2-118aa

AA Sequence : PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Function : Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : MIF family

Tissue Specificity :

Paythway :

Uniprot ID : O35215