Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial

Product Description

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial is available at Gentaur for Next week Delivery.

Gene Name: Dock8

Alternative Names :

Expression Region : 1633-2067aa

AA Sequence : KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 55.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Guanine nucleotide exchange factor which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP. During immune responses, required for interstitial dendritic cell migration by locally activating CDC42 at the leading edge membrane of DC. Required for CD4+ T-cell migration in response to chemokine stimulation by promoting CDC42 activation at T cell leading edge membrane. Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center, and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing.

Function : Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP

Involvement in disease :

Subcellular location : Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families : DOCK family

Tissue Specificity : Expressed in T cells (PubMed:28028151). Expressed in bone marrow-derived dendritic cells (PubMed:25713392).

Paythway :

Uniprot ID : Q8C147