Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5)

Product Description

Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5) is available at Gentaur for Next week Delivery.

Gene Name: Dbil5

Alternative Names : Endozepine-like peptide

Expression Region : 1-87aa

AA Sequence : MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the energy metabolism of the mature sperm.

Function : May be involved in the energy metabolism of the mature sperm.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : ACBP family

Tissue Specificity : Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.

Paythway :

Uniprot ID : O09035