Recombinant Mouse fMet-Leu-Phe receptor (Fpr1), partial

Product Description

Recombinant Mouse fMet-Leu-Phe receptor (Fpr1), partial is available at Gentaur for Next week Delivery.

Gene Name: Fpr1

Alternative Names : N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor

Expression Region : 1-35aa

AA Sequence : MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Sequence Info : Partial

Tag Info : N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Theoretical MW : 33.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Function : High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family

Tissue Specificity : Expressed in neutrophils, dendritic cells, microglia, spleen, lung and liver. Low level of expression in the vomeronasal organ.

Paythway :

Uniprot ID : P33766