Recombinant Mouse Galectin-7 (Lgals7)

Product Description

Recombinant Mouse Galectin-7 (Lgals7) is available at Gentaur for Next week Delivery.

Gene Name: Lgals7

Alternative Names :

Expression Region : 2-136aa

AA Sequence : SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release .

Function : Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Secreted

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : O54974