Product Description
Recombinant Mouse Golgi membrane protein 1 (Golm1), partial is available at Gentaur for Next week Delivery.
Gene Name: Golm1
Alternative Names : Golgi membrane protein GP73 Golgi phosphoprotein 2
Expression Region : 36-393aa
AA Sequence : SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 56.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Unknown. Cellular response protein to viral infection (By similarity).
Function : Unknown. Cellular response protein to viral infection (By similarity).
Involvement in disease :
Subcellular location : Golgi apparatus, cis-Golgi network membrane, Single-pass type II membrane protein
Protein Families : GOLM1/CASC4 family
Tissue Specificity :
Paythway :
Uniprot ID : Q91XA2
Euro
British Pound
US Dollar