Recombinant Mouse Golgi membrane protein 1 (Golm1), partial

Product Description

Recombinant Mouse Golgi membrane protein 1 (Golm1), partial is available at Gentaur for Next week Delivery.

Gene Name: Golm1

Alternative Names : Golgi membrane protein GP73 Golgi phosphoprotein 2

Expression Region : 36-393aa

AA Sequence : SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 56.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Unknown. Cellular response protein to viral infection (By similarity).

Function : Unknown. Cellular response protein to viral infection (By similarity).

Involvement in disease :

Subcellular location : Golgi apparatus, cis-Golgi network membrane, Single-pass type II membrane protein

Protein Families : GOLM1/CASC4 family

Tissue Specificity :

Paythway :

Uniprot ID : Q91XA2